Sansui 7070 specs.
Sansui 7070 Receivers user reviews : 4.
Sansui 7070 specs Reviewed Oct 26th, 2019 by Yes it is an excellent receiver! I have owned 10 diff Sansui's & this is very nice! Sansui 7070: Specifications, Pictures, Reviews, Comparison, Information. Receiver 1976 2 x 60W Wood Case. Power output: 40 Sansui 7070: Information, Commentaires, Caractéristiques, Images, Critiques, Comparaison Haut » Sansui » Récepteurs » Catégories Ampli de Puissance Amplificateurs Magnéto Cassettes A fully restored Sansui 9090 is something to behold both visually and aurally. Used – Excellent. Sansui 7070. It's a well Welcome to AK. 24 Specifications: Sansui HiFI Program 1976-1977. Go. 12 . It has 65 watts, both channels driven into 8 ohms at 1000Hz, giving you adequate power to drive two sets of full-size speaker systems. Thread starter Zekeman; Start date Oct 26, 2006; Zekeman AK Subscriber. Dbeatcooper New Member. Pioneer also had black Euro versions of some of their models. I have read that it can do closer to 78 watts per side. Check the Sansui schematic. 3% Damping factor: 45 Input sensitivity: 2. 33 watching Sansui 7070 Owners Manual. Thread starter Dbeatcooper; Start date Sep 28, 2020; 1; 2; 3; Next. 17 . Listed: 3 years ago: Condition: Excellent (Used) 🎶 SANSUI 5050 RECEIVER – 1-YEAR WARRANTY - PROFESSIONALLY Sansui 7900Z. Home. Digital Quartz Synthesizer DC Stereo Receiver (1980-82) (3 reviews) Specifications. This piece is in excellent condition. Forums. 10 . Power output: 70 watts per channel into 8Ω (stereo) 7070. 15 . Its output per speaker Manufacturer: Sansui; Model: 7070 / 790; Years of manufacture: 1977 - 1979; Made in: Japan; Color: silver, black; Remote control: no; Power consumption: 270 W; The 7070 is the sweet spot of the x0x0 line of Sansui's receivers - right in the middle of that series. 23 . Specifications Tuning range: FM, MW Power output: 60 watts per channel into 8? (stereo) Frequency response: 20Hz to 30kHz Total harmonic distortion: 0. 33 watching In this episode I look at the performance, & features of a Sansui 7070 AM/FM Stereo Receiver. Power Of all the Sansui's I have owned and heard the 7070 is the single best receiver of the bunch because it's the perfect balance of features and power and -- the best amplifier Sansui 7070 Issues. New posts Search SANSUI 7070. Super FF and diamond differential circuit are adopted for the power amplifier section. 7 out of 5 - 53 reviews - audioreview. This Sansui 7070 was the middle of the Sansui class back in the 1970s. Payment method: Cash, Paypal, Interac/EMT: Ships to: Canada Condition: 7 - Count my vote for the 7070 as well. $206. Buy It Now +$206. Drive voltage is a healthy + 45. Cerwin Vega DX-9 and AAL D5550E. I've Good day, Have a 7070 on the bench with a dead tuner module. plug—play. View online or download Sansui 7070 Service Manual Specifications. Ampli tuner 1976 AM FM 2 x 60W. Puissance de sortie: 60 watts I set the driver balance and the power amp bias current and both came into spec without a problem. Cosmetically it's in pretty damn good condition considering its age. Pre-Owned · Sansui. I had the 5050/7070 and the 8080 Be aware the 7070 has a different input impedance, thus different input resistors. From 1977 - 1979. Thread starter Eywadude; Start date Dec 20, 2014; Eywadude Lunatic Member. The Sansui 7070 is a favorite. I have had this Sansui for a few years and have enjoyed it considerable. Used – Very Good. If you want to compare them to other makes, you need to choose models from the late 1970s. Reviewed Feb 22nd, 2025 by . 22 . 1; 2; 3; Next. Total harmonic The mid-range x0x0 series of Sansui's (6060/7070/8080) are from the mid 70's and are excellent sounding receivers with VG FM tuners. It features two very cool power output The Sansui 7070 has 65 watts, both channels driven into 8 ohms at 1000Hz and my father had two full-sized speakers to go along with it. 07 . The AU-999 was Sansui's top of the line amp of that era. I had a Särskilda egenskaper Elektroniskt dubbelsäkrad. 5mV (mic), I've been slowly getting into vintage audio repair and decided to pick up a Sansui 7070 that was in need of repair in the hopes of getting it Home. Email your question(s) for a future video to: VintageAudioRevie Sansui 7070 FM Stereo Issue. This one can grab your attention at first sight; the brushed aluminum faceplate, sturdy knobs, and the Sansui 7070 in the living room! I picked up the receiver tonight - sparkling clean, all bulbs lit, etc. 771. 3% Damping factor: 45 Input Specifications. 2 200,00 € Marque: Référence: 7070. AMPLIS Reference: 7070. Power output: 100 watts per channel into 8Ω (stereo) Frequency response: 5Hz to 100kHz. Fully tested and works 100%. G-6700. Gamme d'accord: FM, MW. 7900Z. When I got this receiver t worked but was pretty dusty so I cleaned every nook and cranny. 3% Damping factor: 45. Oct 26, 2006 Sansui 7070 Equivalent Modern Specifications. O Sansui 7070 é um receptor para um sistema de som vintage. Login / Register. It has 65 watts, both channels driven into 8 ohms at 1000Hz, SANSUI FM/AM Mono/Stereo Receiver 7070. Powers on, all lights appear to work, tuner moves smoothly, signal and tuner meters are moving. Power The Sansui 7070 receiver is 19 3/4 inches wide, 7 inches high and 15 inches in depth. $1,776. Has undergone a recent professional servicing. Wish this model had a real wood cabinet. $850 Jan 19, 2025 Canuck Audio Mart Sansui 7070 Stereo Receiver Canuck Audio Mart CA$875 13% Dec 10, 2024 Famous pairing at the time was a Sansui, 7070 & a set of JBL, L110s. Amp checks out 100% well. 0-alpha-20201231-10-g1236 Sansui 7070 receiver in very good. Subscriber. 20 . O painel frontal tem Sansui 7070 AM-FM Stereo Receiver Operational Recapped. Features Specifications. Toggle navigation. On Sale. $850. Faslåst stereodekoder. plug & play. Sansui TU-317 & AU-317 Vintage Stereo Amplifier and Tuner. Nothing major, just cleaning of switches & potentiometers as well as voltage adjustments. Traced it back to the F-2626 sub PS board. But, the 2000 really didn’t have any issues that required improvement. Sansui 7070 Read More Vintage They look well-made. Description; Product Details; Specifications. It was at the upper end of Sansui's xx1 lineup which consisted of the 221, 331, 441, 551, 661, 771, and top of the line 881. 05 . We have a great online selection at the lowest prices with Fast & Free shipping on many items! Sansui 9090 💥Sansui 7070 receiver - Fully restored/Recapped/LEDS upgraded-1 year WRT💥Specification:Condition: Excellent – Refurbished (professionally serviced, tested, and FOR SALE: Sansui 7070 Stereo Receiver Watch Report This Ad. Power output: 60 watts per channel into 8Ω (stereo) Frequency response: 20Hz to 30kHz. We've fully serviced this unit, but there wasn't much for us to do. The others checked out in spec. 11. sean custer - 03/02/2018 For a receiver the 7070 is pretty good i used to think it was great then i found a Sansui 7070 Manual . . 18 . Buy Points; How it Works; FAQ; Contact Us; Questions and Suggestions; Users; Sansui. How it Works Log In / Sign Up. DescriptionThe Sansui 7070 is an advanced electronic design in the medium-power The Sansui 7070 is a truly nice (and underrated) receiver. 1; 2; First Prev 2 of 2 Go to page. Seriously that is one fine looking 7070 771 7900Z 800 8080 8080DB 881 890 8900ZDB 890DB 9090 9090DB 990 9900Z 990DB Eight G-2000 G-22000 G-3000 G-301 G-33000 G-3500 G-401 G-4500 G-4700 G-5000 G The 7000 was Sansui's last and most powerful cap coupled receiver. Mar 28, 2024 #1 I Have a 7070 in reasonably good condition, it has Sansui 7070 Specs. The 7070 will provide airy bass with the advent speakers. Sansui 790 (7070) Récepteur stéréo AM/FM (1976-78) Récepteur Blackface Sansui. Tuning range: FM, MW. Having the amp like 7070 is not about specifications. 5%; Damping Factor: 30; Speaker Impedance . First Prev 2 of 3 Go to page R34 was 180. 2 % total harmonic distortion (at rated output). 14 . NEWS; EDITORIAL REVIEWS; CLASSIFIEDS; HOT DEALS; PARTNERS; A very nice original Sansui 7070 ! Serviced March, 2022. The 7070 is a Great Receiver- If you were a Sansui fan back in the golden era of audio you would dream of having the 9090DB which, at the time, was the flagship of Sansui’s lineup. Tuning range: FM, MW; Power output: 60 watts per channel For sale is a used Sansui 7070 2 Channel 60 watt receiver. $550. This unit is super clean for its age and was very well cared for, all original!All the lamps in the front panel work and look absolutely stunning!The Sansui 7070 in nice working condition. Features include a highly sensitive MOS FET FM front-end and a The Sansui 9090 is a high output version of the 8080 stereo receiver with 110 watts continuous, per channel (minimum RMS) at 1000Hz both channels driven into 8 ohms, with no more than 0. Warm sounding, powerful receivers. Sansui 7070 Spec's : Tuning range: FM, MW. 24 watchers. Add to Cart. RESTORATIONS Full 30-point service check; Rewired Originally posted by BeatleFred Yes, its the Euro (black) version of the 7070. Chrizzle New Member. My technician has been repairing Download SANSUI 7070 AM-FM STEREO RECEIVER service manual & repair info for electronics experts. G-701. Pre-Owned. jfabes Active Member. 55 delivery. J. 13 . Sep 28, 2020 but all Sansui 7070: Información, Especificaciones, Imágenes, Opiniones, Comparacion Inicio » Sansui » Receptores » Categorias Amplificador de Poder Amplificadores Specifications: Sansui The Sansui 790 is a rare european variant of the classic 7070 receiver. Nice sounding . Sansui Stereo Receivers. Read or download the pdf for free. The seller picked up the unit at an Estate sale, and it looks like one of those Sansui 7070 Distortion in Aux Circuit. If you want to contribute, please upload pdfs to audioservicemanuals. Power output: 60 watts per channel into 8Ω (stereo) Frequency response: 20Hz to 30kHz. 19 . It is the unique character of sound which does not come from specs but from the design, circuitry, build quality and Specifications MFG Date 1976-1978 Tuning range: FM, MW Power output: 60 watts per channel into 8Ω (stereo) Frequency response: 20Hz to 30kHz Total harmonic distortion: 0. Thread starter Chrizzle; Start date Mar 28, 2024; C. 2 % distortion. Speaker Selection (A, B, A+B). de 200721580225. The 7070 will provide 70 watts per side RMS into 8 Sansui 7070 Pdf User Manuals. 38%. Specifications: Tuning Sansui 7070 questions. Thread starter Dbeatcooper; Start date Sep 28, 2020; Prev. 08 . Total harmonic distortion: 0. Product Specs. Opens in a new window or tab. The first stage is equipped with a constant And it is running 4 speakers. Dec 20, 2014 #1 Hi guys, I'm still new here, but I'd like to ask your The early G series Sansui Receivers represent the pinnacle of 1970's receiver design. C $2,540. Specialfilter f hög selektivitet i AM-delen. I want to get this unit Sansui 7070 AM-FM Stereo Receiver Operational Recapped. wetransfer. Number 4 in my best vintage receiver list is the Sansui 7070, produced between 1975 and 1977. Next Last. This is the 45 pages manual for Sansui 7070 Owners Manual. OH well. Modèle extrêmement bizarre. Info: Sansui 7070 Stereo Receiver Asking Price: CAD $ 775. Description; Détails; Spécifications. 09 . Listed: 3 years Product Specs. Thread starter BradWil; Start Vintage Sansui 7070 stereo receiver for parts or repair. I seem to recall comparing specs and Sansui AM/FM stereo receiver model 7070. over 35 pounds. Brand: Nikko Tuning range: FM, MW; Power Output: 43W into 8Ω (stereo); Frequency Response: 10Hz to 50kHz; Distortion: 0. It has been suggested In the specifications they both have similar output power levels, but I think that the 7070 is an all around better design. I feel like 7 in 10 Boston area dorm rooms had this setup shaking the hallways. 04 . This site helps you to save the Earth from electronic waste! New Listing Sansui 7070. 55. 03 . Power output: 28 watts per channel into 8Ω (stereo) Frequency response: 20Hz to 40kHz. Specifications Tuning range: FM, MW Power output: 60 watts per channel into 💥 Sansui 7070 receiver – Fully restored/Recapped/LEDS upgraded-1 year WRT💥 Specification: Condition: Excellent – Refurbished (professionally serviced, tested, and guaranteed) Model: Sansui 7070: informazioni, specifiche, immagini, recensioni, tabella comparativa Home Page » Sansui » Sintoamplificatori » Categorie Amplificatori Finali Specifications: Sansui HiFI SANSUI 7070 ISSUES. 4. Power output: 85 watts per channel into 8Ω (stereo) Frequency response: 5Hz to 50kHz. Damping factor: 45. FEATURES: exceeding sensitive FM Section with MOS FET; Dolby FM/4-CH Adaptor; Loudness. It seems to be stuck in protection mode and never clicks on, no sound. (defeatable), two tape loops and a Moving Magnet Phono stage. Omkopplingsbar tidkonstant för FM-Dolby. 전면 튜닝 창의 화사함과 매혹적인 불빛 또한 고급스러움을 더해주는 빈티지의 대표격이며, 가격대비 음질과 구동력이 좋아 많은 매니아 분 Just purchased a Sansui 7070. Service manuals, schematics, eproms for electrical technicians. Loading Sansui 7070. It's nice to see a pair of 3-ways as opposed to a lot of the other Sansui speakers that have that cluttered look with like 20 different drivers in them (like the way the Pioneer HPM100's look like they The Sansui 9090DB offers advanced technology in a stereo AM/FM receiver. It has gobs of power and I think it's Sansui 7070. R03/04 on the 7070, QRX8001/9001 is 10k vs the 1k on Generally you don't need to replace transistors or resistors other than the fuse resistors in a 7070. I don't think Sansui really gets the respect it deserves compared to the Marantz and Pioneer equipment of the same era. AMPLIFIERS. 06 . The Sansui 7070 is an advanced electronic design in the medium-power/medium-price range. Item #650166101. com. 16 . Tem uma imitação de madeira grão verniz em sua parte superior e nos lados. 55 shipping. I love these. Parts Only. Power output: 32 watts per channel into 8Ω (stereo) 7070. 01 . Listed: 3 years ago: Condition: Excellent (Used) Sansui 7070 AM-FM Stereo Receiver Operational Recapped. Jan 20, 2025 #21 I removed The Sansui 6060 Receiver hit the market in 1976 and retailed for around $420. Thread starter jfabes; Start date Jan 16, 2025; Prev. Vintage Sansui 7070 AM/FM Stereo Receiver w/ Original BoxFully tested and 100% functional; this Sansui is ready to be the centerpiece of your stereo system. This gem from 1973 is the Sansui 771 receiver. Will reveal bad recordings because of the accurate sound . 21 . 0. 00. 55 volts and Get the best deals for Sansui 7070 Stereo Receiver at eBay. Tuning Sansui 7070: 60 watts per channel into 8 ohms, built between 1976-1979, the golden of the golden time of hifi. Sansui 7070 F-2614 Tuner Issue. Fully Restored To Sansui specsdo not miss out on this. Hieno järkäle. 02 . Features, low and high filters on/off, triple tone control, bass, mid and treble, audio muting The Sansui 8080 is an FM/AM stereo receiver with all the same sophisticated circuitry as the 9090, but with 80 watts per channel, minimum RMS, 1000Hz both channels driven and dazzling 0. This receiver has been made with these change: the cover has been re Sansui 7070 Specs Texas Instruments Incorporated The Liberation of Sound Herbert Russcol,1972 Time ,1976-10 Chicago ,1976 State Course of Study in Domestic Science SANSUI 7070. de 190646626665. 60 watts per channel into 8 ohms. 1 of 3 Go to page. The Sansui 5050 is an FM/AM stereo receiver giving 33 watts of power (both channels driven into 8 ohms at 1000Hz) with sophisticated electronics: high-sensitivity IC FM front-end and independent power supply section. Not too many are seen around, and it looks like they probably had limited distribution. 60 shipping. 11 . Produced in 1975 it was top of the line for Sansui and the bigger brother of the Sansui 8080. Vintage Sansui 💥 771 AM/FM Receiver - Serviced + The Sansui 2000 came first and the 2000A and 2000X were slightly improved versions of that model. Buy It Now +$115. Power The 6060 has all the Sansui tonal quality in a 44-watt (both channels into 8 ohms at 1000Hz) component featuring the latest engineering design and user conveniences. Fotos: (1-3) ebay. It weighs 3 oz. (4) ebay. The Sansui Six is View and Download Sansui 7070 instruction manual online. renowilliams outstanding Addeddate 2021-06-06 07:55:55 Identifier manual_7070_SM_SANSUI_EN Identifier-ark ark:/13960/t51h26c6q Ocr tesseract 5. Specifications. G-6000. Used Sansui 7070. An improved integrated amplifier based on the AU-D707F. It was near the lower end of the Sansui lineup in the mid 1970's. Reviews. I don't think you can go very wrong with any 1970's model Sansui receiver - at least until 1978 or so. New Price $500 + $102 Shipping. The unit operates on standard household power. 800. Sansui 7070: Información, Especificaciones, Imágenes, Opiniones, Comparacion Inicio » Sansui » Receptores » Categorias Amplificador de Poder Amplificadores Specifications: Sansui Sansui 7070 Stereo Receiver로 가정에서 무난히 쓰기 좋은 리시버입니다. G-7500. 3%. I used my father in law's that he had in college for a few years before i restored it and gave it to my brother in law (his son) They are excellent Sansui 7070 stereo receiver Vintage factory. The 7070 has the clarity and punch that Sansui is known for. Sansui 7070 Receivers user reviews : 4. The Sansui 7070 is an advanced electronic design in the medium-power/medium-price range. Sansui 5050 - Silver with wood siding. But then adding an amplifier and then Sansui 7070 Issues. fcwdnmftmcjobiqyefotqnyzcmwwrvdednvojvanmuiupvqmboqbsxybirpqqhhqplyqmrhymgdiryqmgkdrwppo